Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 5095912..5096648 | Replicon | chromosome |
Accession | NZ_CP100753 | ||
Organism | Serratia marcescens strain SASK1000 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NLX77_RS24360 | Protein ID | WP_076741273.1 |
Coordinates | 5095912..5096391 (-) | Length | 160 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A5C7DAD3 |
Locus tag | NLX77_RS24365 | Protein ID | WP_015379309.1 |
Coordinates | 5096388..5096648 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX77_RS24335 (NLX77_24335) | 5091559..5092032 | - | 474 | WP_004930745.1 | transcription elongation factor GreB | - |
NLX77_RS24340 (NLX77_24340) | 5092262..5093224 | + | 963 | WP_118892666.1 | curved DNA-binding protein | - |
NLX77_RS24345 (NLX77_24345) | 5093230..5093535 | + | 306 | WP_004930739.1 | chaperone modulator CbpM | - |
NLX77_RS24350 (NLX77_24350) | 5093793..5094512 | + | 720 | WP_004709363.1 | two-component system response regulator OmpR | - |
NLX77_RS24355 (NLX77_24355) | 5094509..5095879 | + | 1371 | WP_015379311.1 | two-component system sensor histidine kinase EnvZ | - |
NLX77_RS24360 (NLX77_24360) | 5095912..5096391 | - | 480 | WP_076741273.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLX77_RS24365 (NLX77_24365) | 5096388..5096648 | - | 261 | WP_015379309.1 | plasmid stability-like protein | Antitoxin |
NLX77_RS24370 (NLX77_24370) | 5096776..5098395 | - | 1620 | WP_254520036.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
NLX77_RS24375 (NLX77_24375) | 5098590..5099468 | - | 879 | WP_015379307.1 | Hsp33 family molecular chaperone HslO | - |
NLX77_RS24380 (NLX77_24380) | 5099494..5099901 | - | 408 | WP_015379306.1 | ribosome-associated heat shock protein Hsp15 | - |
NLX77_RS24385 (NLX77_24385) | 5099898..5100578 | - | 681 | WP_004930298.1 | GMP/IMP nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 18028.66 Da Isoelectric Point: 5.9070
>T251368 WP_076741273.1 NZ_CP100753:c5096391-5095912 [Serratia marcescens]
MIVLDTNVVSELLRPAPHYNVLRWLDEQDTYRFYLSAIVVAELYTGIACMPHGKKQLELQTNLGDMLQEEFSDRILPFDV
GCAMQHAELMGANRRRGIGVSMPDTQIAATCLHYGATLATRNTKDFLHCGIELIDPWQAPTGRRLHEDAAEYYVMSRKS
MIVLDTNVVSELLRPAPHYNVLRWLDEQDTYRFYLSAIVVAELYTGIACMPHGKKQLELQTNLGDMLQEEFSDRILPFDV
GCAMQHAELMGANRRRGIGVSMPDTQIAATCLHYGATLATRNTKDFLHCGIELIDPWQAPTGRRLHEDAAEYYVMSRKS
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|