Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3672259..3672880 | Replicon | chromosome |
| Accession | NZ_CP100753 | ||
| Organism | Serratia marcescens strain SASK1000 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
| Locus tag | NLX77_RS17715 | Protein ID | WP_004940313.1 |
| Coordinates | 3672677..3672880 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
| Locus tag | NLX77_RS17710 | Protein ID | WP_004940312.1 |
| Coordinates | 3672259..3672627 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX77_RS17680 (NLX77_17680) | 3668358..3668612 | + | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
| NLX77_RS17685 (NLX77_17685) | 3668625..3668765 | + | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| NLX77_RS17690 (NLX77_17690) | 3668873..3669751 | - | 879 | WP_254519854.1 | metal ABC transporter substrate-binding protein | - |
| NLX77_RS17695 (NLX77_17695) | 3669777..3670634 | - | 858 | WP_044031827.1 | metal ABC transporter permease | - |
| NLX77_RS17700 (NLX77_17700) | 3670631..3671344 | - | 714 | WP_118892386.1 | ABC transporter ATP-binding protein | - |
| NLX77_RS17705 (NLX77_17705) | 3671747..3672100 | + | 354 | WP_004940311.1 | hypothetical protein | - |
| NLX77_RS17710 (NLX77_17710) | 3672259..3672627 | + | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
| NLX77_RS17715 (NLX77_17715) | 3672677..3672880 | + | 204 | WP_004940313.1 | HHA domain-containing protein | Toxin |
| NLX77_RS17725 (NLX77_17725) | 3673464..3673778 | + | 315 | WP_015376856.1 | MGMT family protein | - |
| NLX77_RS17730 (NLX77_17730) | 3673843..3674334 | - | 492 | WP_015376855.1 | YbaY family lipoprotein | - |
| NLX77_RS17735 (NLX77_17735) | 3674566..3675429 | + | 864 | WP_015376854.1 | acyl-CoA thioesterase II | - |
| NLX77_RS17740 (NLX77_17740) | 3675520..3676806 | - | 1287 | WP_004940322.1 | ammonium transporter AmtB | - |
| NLX77_RS17745 (NLX77_17745) | 3676843..3677181 | - | 339 | WP_004940327.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T251367 WP_004940313.1 NZ_CP100753:3672677-3672880 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT251367 WP_004940312.1 NZ_CP100753:3672259-3672627 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4G7F9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X2G5J9 |