Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3672259..3672880 Replicon chromosome
Accession NZ_CP100753
Organism Serratia marcescens strain SASK1000

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag NLX77_RS17715 Protein ID WP_004940313.1
Coordinates 3672677..3672880 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag NLX77_RS17710 Protein ID WP_004940312.1
Coordinates 3672259..3672627 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX77_RS17680 (NLX77_17680) 3668358..3668612 + 255 WP_004940303.1 type B 50S ribosomal protein L31 -
NLX77_RS17685 (NLX77_17685) 3668625..3668765 + 141 WP_004940304.1 type B 50S ribosomal protein L36 -
NLX77_RS17690 (NLX77_17690) 3668873..3669751 - 879 WP_254519854.1 metal ABC transporter substrate-binding protein -
NLX77_RS17695 (NLX77_17695) 3669777..3670634 - 858 WP_044031827.1 metal ABC transporter permease -
NLX77_RS17700 (NLX77_17700) 3670631..3671344 - 714 WP_118892386.1 ABC transporter ATP-binding protein -
NLX77_RS17705 (NLX77_17705) 3671747..3672100 + 354 WP_004940311.1 hypothetical protein -
NLX77_RS17710 (NLX77_17710) 3672259..3672627 + 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
NLX77_RS17715 (NLX77_17715) 3672677..3672880 + 204 WP_004940313.1 HHA domain-containing protein Toxin
NLX77_RS17725 (NLX77_17725) 3673464..3673778 + 315 WP_015376856.1 MGMT family protein -
NLX77_RS17730 (NLX77_17730) 3673843..3674334 - 492 WP_015376855.1 YbaY family lipoprotein -
NLX77_RS17735 (NLX77_17735) 3674566..3675429 + 864 WP_015376854.1 acyl-CoA thioesterase II -
NLX77_RS17740 (NLX77_17740) 3675520..3676806 - 1287 WP_004940322.1 ammonium transporter AmtB -
NLX77_RS17745 (NLX77_17745) 3676843..3677181 - 339 WP_004940327.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T251367 WP_004940313.1 NZ_CP100753:3672677-3672880 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT251367 WP_004940312.1 NZ_CP100753:3672259-3672627 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References