Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 3176633..3177180 | Replicon | chromosome |
| Accession | NZ_CP100753 | ||
| Organism | Serratia marcescens strain SASK1000 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A1Q4P6P4 |
| Locus tag | NLX77_RS15255 | Protein ID | WP_073528876.1 |
| Coordinates | 3176633..3176941 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A0G3SUU9 |
| Locus tag | NLX77_RS15260 | Protein ID | WP_033633717.1 |
| Coordinates | 3176944..3177180 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX77_RS15235 (NLX77_15235) | 3172402..3173559 | - | 1158 | WP_004938972.1 | YbfB/YjiJ family MFS transporter | - |
| NLX77_RS15240 (NLX77_15240) | 3173665..3174585 | + | 921 | WP_118892277.1 | LysR family transcriptional regulator | - |
| NLX77_RS15245 (NLX77_15245) | 3174615..3175739 | + | 1125 | WP_015377215.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| NLX77_RS15250 (NLX77_15250) | 3175754..3176596 | + | 843 | WP_118892278.1 | S-formylglutathione hydrolase | - |
| NLX77_RS15255 (NLX77_15255) | 3176633..3176941 | - | 309 | WP_073528876.1 | CcdB family protein | Toxin |
| NLX77_RS15260 (NLX77_15260) | 3176944..3177180 | - | 237 | WP_033633717.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NLX77_RS15265 (NLX77_15265) | 3177268..3178176 | - | 909 | WP_254519799.1 | glutathione ABC transporter permease GsiD | - |
| NLX77_RS15270 (NLX77_15270) | 3178186..3179106 | - | 921 | WP_004938995.1 | glutathione ABC transporter permease GsiC | - |
| NLX77_RS15275 (NLX77_15275) | 3179159..3180694 | - | 1536 | WP_118892279.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11448.21 Da Isoelectric Point: 5.0196
>T251366 WP_073528876.1 NZ_CP100753:c3176941-3176633 [Serratia marcescens]
MQFTVYDNTYPASAYPYLLDVQSDLIDALSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGKA
VGNANEHRNQIKAAIDFLIDGF
MQFTVYDNTYPASAYPYLLDVQSDLIDALSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGKA
VGNANEHRNQIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4P6P4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0G3SUU9 |