Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3047056..3047581 | Replicon | chromosome |
Accession | NZ_CP100753 | ||
Organism | Serratia marcescens strain SASK1000 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NLX77_RS14695 | Protein ID | WP_015377296.1 |
Coordinates | 3047297..3047581 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A8B4GIN1 |
Locus tag | NLX77_RS14690 | Protein ID | WP_004928423.1 |
Coordinates | 3047056..3047307 (+) | Length | 84 a.a. |
Genomic Context
Location: 3042330..3042872 (543 bp)
Type: Others
Protein ID: WP_015377301.1
Type: Others
Protein ID: WP_015377301.1
Location: 3043135..3043863 (729 bp)
Type: Others
Protein ID: WP_004928406.1
Type: Others
Protein ID: WP_004928406.1
Location: 3043896..3044627 (732 bp)
Type: Others
Protein ID: WP_004928409.1
Type: Others
Protein ID: WP_004928409.1
Location: 3044637..3045353 (717 bp)
Type: Others
Protein ID: WP_004928413.1
Type: Others
Protein ID: WP_004928413.1
Location: 3045353..3046021 (669 bp)
Type: Others
Protein ID: WP_015377298.1
Type: Others
Protein ID: WP_015377298.1
Location: 3046220..3046954 (735 bp)
Type: Others
Protein ID: WP_015377297.1
Type: Others
Protein ID: WP_015377297.1
Location: 3047056..3047307 (252 bp)
Type: Antitoxin
Protein ID: WP_004928423.1
Type: Antitoxin
Protein ID: WP_004928423.1
Location: 3047297..3047581 (285 bp)
Type: Toxin
Protein ID: WP_015377296.1
Type: Toxin
Protein ID: WP_015377296.1
Location: 3047578..3048705 (1128 bp)
Type: Others
Protein ID: WP_118892261.1
Type: Others
Protein ID: WP_118892261.1
Location: 3048775..3049254 (480 bp)
Type: Others
Protein ID: WP_015377294.1
Type: Others
Protein ID: WP_015377294.1
Location: 3049359..3050204 (846 bp)
Type: Others
Protein ID: WP_254519784.1
Type: Others
Protein ID: WP_254519784.1
Location: 3050201..3051163 (963 bp)
Type: Others
Protein ID: WP_021504359.1
Type: Others
Protein ID: WP_021504359.1
Location: 3051188..3052321 (1134 bp)
Type: Others
Protein ID: WP_049187444.1
Type: Others
Protein ID: WP_049187444.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX77_RS14660 (NLX77_14660) | 3042330..3042872 | + | 543 | WP_015377301.1 | lipoprotein | - |
NLX77_RS14665 (NLX77_14665) | 3043135..3043863 | + | 729 | WP_004928406.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NLX77_RS14670 (NLX77_14670) | 3043896..3044627 | + | 732 | WP_004928409.1 | arginine ABC transporter substrate-binding protein | - |
NLX77_RS14675 (NLX77_14675) | 3044637..3045353 | + | 717 | WP_004928413.1 | arginine ABC transporter permease ArtQ | - |
NLX77_RS14680 (NLX77_14680) | 3045353..3046021 | + | 669 | WP_015377298.1 | arginine ABC transporter permease ArtM | - |
NLX77_RS14685 (NLX77_14685) | 3046220..3046954 | + | 735 | WP_015377297.1 | arginine ABC transporter substrate-binding protein | - |
NLX77_RS14690 (NLX77_14690) | 3047056..3047307 | + | 252 | WP_004928423.1 | prevent-host-death protein | Antitoxin |
NLX77_RS14695 (NLX77_14695) | 3047297..3047581 | + | 285 | WP_015377296.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLX77_RS14700 (NLX77_14700) | 3047578..3048705 | - | 1128 | WP_118892261.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
NLX77_RS14705 (NLX77_14705) | 3048775..3049254 | - | 480 | WP_015377294.1 | YbjO family protein | - |
NLX77_RS14710 (NLX77_14710) | 3049359..3050204 | - | 846 | WP_254519784.1 | putrescine ABC transporter permease PotI | - |
NLX77_RS14715 (NLX77_14715) | 3050201..3051163 | - | 963 | WP_021504359.1 | putrescine ABC transporter permease PotH | - |
NLX77_RS14720 (NLX77_14720) | 3051188..3052321 | - | 1134 | WP_049187444.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10803.94 Da Isoelectric Point: 10.6941
>T251365 WP_015377296.1 NZ_CP100753:3047297-3047581 [Serratia marcescens]
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHIPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
MTYKLEFEEHALKEFKKLSPVIREQFKKKLASVLVNPHIPANKLAGLPDCYKIKLRASGFRLVYRVMETEIVVLVLSVGK
RERSAAYTAAKKRL
Download Length: 285 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4GIN1 |