Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1684342..1684970 Replicon chromosome
Accession NZ_CP100753
Organism Serratia marcescens strain SASK1000

Toxin (Protein)


Gene name hicA Uniprot ID A0A0P0QK57
Locus tag NLX77_RS08000 Protein ID WP_015378230.1
Coordinates 1684767..1684970 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A086GDG8
Locus tag NLX77_RS07995 Protein ID WP_015378231.1
Coordinates 1684342..1684755 (-) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX77_RS07965 (NLX77_07965) 1679575..1680297 + 723 WP_004934752.1 RNA polymerase sigma factor FliA -
NLX77_RS07970 (NLX77_07970) 1680352..1680861 + 510 WP_004934751.1 flagella biosynthesis regulatory protein FliZ -
NLX77_RS07975 (NLX77_07975) 1680986..1681978 + 993 WP_015378235.1 D-cysteine desulfhydrase -
NLX77_RS07980 (NLX77_07980) 1682094..1682894 + 801 WP_015378234.1 cystine ABC transporter substrate-binding protein -
NLX77_RS07985 (NLX77_07985) 1682894..1683556 + 663 WP_118891942.1 cystine ABC transporter permease -
NLX77_RS07990 (NLX77_07990) 1683560..1684312 + 753 WP_015378232.1 L-cystine ABC transporter ATP-binding protein TcyN -
NLX77_RS07995 (NLX77_07995) 1684342..1684755 - 414 WP_015378231.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NLX77_RS08000 (NLX77_08000) 1684767..1684970 - 204 WP_015378230.1 type II toxin-antitoxin system HicA family toxin Toxin
NLX77_RS08005 (NLX77_08005) 1685137..1689108 - 3972 WP_254520224.1 trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fliA / fliZ 1679575..1691163 11588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-129)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 7523.89 Da        Isoelectric Point: 11.1475

>T251360 WP_015378230.1 NZ_CP100753:c1684970-1684767 [Serratia marcescens]
VKSSELIALLESHGWVLRRVKGSHHQFKHPDFALIITVPHPKKDLKLGTLRQILKDAGLSALHIATR

Download         Length: 204 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 14888.63 Da        Isoelectric Point: 5.4867

>AT251360 WP_015378231.1 NZ_CP100753:c1684755-1684342 [Serratia marcescens]
MFYPAYIHTESNGSASGFFPDVPGCYFAGTSLDDAFADAQSALDAHFELLSEDNQPLPRPHAVAAHLAKDAGSFEGGQWL
LVAINMDKFDGRAERINITLPHRLLSRIDSLVRQHPGYGSRSGFLAAAARNELLKAE

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P0QK57

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDG8

References