Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 891239..891895 | Replicon | chromosome |
| Accession | NZ_CP100753 | ||
| Organism | Serratia marcescens strain SASK1000 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NLX77_RS04225 | Protein ID | WP_021504433.1 |
| Coordinates | 891506..891895 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NLX77_RS04220 | Protein ID | WP_254520151.1 |
| Coordinates | 891239..891502 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX77_RS04200 (NLX77_04200) | 886277..887491 | - | 1215 | WP_015378743.1 | D-galactonate dehydratase family protein | - |
| NLX77_RS04205 (NLX77_04205) | 887660..888565 | - | 906 | WP_015378742.1 | lipid kinase YegS | - |
| NLX77_RS04210 (NLX77_04210) | 889032..890384 | - | 1353 | WP_004941558.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| NLX77_RS04215 (NLX77_04215) | 890563..890901 | - | 339 | WP_004941561.1 | YegP family protein | - |
| NLX77_RS04220 (NLX77_04220) | 891239..891502 | + | 264 | WP_254520151.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NLX77_RS04225 (NLX77_04225) | 891506..891895 | + | 390 | WP_021504433.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLX77_RS04230 (NLX77_04230) | 891903..892619 | - | 717 | WP_015378739.1 | two-component system response regulator BaeR | - |
| NLX77_RS04235 (NLX77_04235) | 892619..894001 | - | 1383 | WP_254520152.1 | two-component system sensor histidine kinase BaeS | - |
| NLX77_RS04240 (NLX77_04240) | 893998..895428 | - | 1431 | WP_103086182.1 | multidrug transporter subunit MdtD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14398.63 Da Isoelectric Point: 8.4983
>T251358 WP_021504433.1 NZ_CP100753:891506-891895 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|