Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 521750..522419 | Replicon | chromosome |
Accession | NZ_CP100753 | ||
Organism | Serratia marcescens strain SASK1000 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NLX77_RS02485 | Protein ID | WP_004931681.1 |
Coordinates | 521997..522419 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
Locus tag | NLX77_RS02480 | Protein ID | WP_004931679.1 |
Coordinates | 521750..522016 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX77_RS02455 (NLX77_02455) | 517317..518243 | + | 927 | WP_015378971.1 | ribokinase | - |
NLX77_RS02460 (NLX77_02460) | 518284..518892 | - | 609 | WP_004931670.1 | HD domain-containing protein | - |
NLX77_RS02465 (NLX77_02465) | 519076..519750 | + | 675 | WP_021505704.1 | hemolysin III family protein | - |
NLX77_RS02470 (NLX77_02470) | 519901..520398 | + | 498 | WP_044030541.1 | DUF2165 domain-containing protein | - |
NLX77_RS02475 (NLX77_02475) | 520437..521429 | - | 993 | WP_044030542.1 | tRNA-modifying protein YgfZ | - |
NLX77_RS02480 (NLX77_02480) | 521750..522016 | + | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
NLX77_RS02485 (NLX77_02485) | 521997..522419 | + | 423 | WP_004931681.1 | protein YgfX | Toxin |
NLX77_RS02490 (NLX77_02490) | 522485..523003 | - | 519 | WP_004931683.1 | flavodoxin FldB | - |
NLX77_RS02495 (NLX77_02495) | 523110..524009 | + | 900 | WP_004931685.1 | site-specific tyrosine recombinase XerD | - |
NLX77_RS02500 (NLX77_02500) | 524036..524752 | + | 717 | WP_254520105.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NLX77_RS02505 (NLX77_02505) | 524759..526492 | + | 1734 | WP_015378966.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16487.59 Da Isoelectric Point: 11.0198
>T251356 WP_004931681.1 NZ_CP100753:521997-522419 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEQG
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEQG
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|