Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1386720..1387636 | Replicon | chromosome |
Accession | NZ_CP100752 | ||
Organism | Bacillus halotolerans strain MEC_B301 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A7G7U9Y2 |
Locus tag | NLV76_RS07285 | Protein ID | WP_024121091.1 |
Coordinates | 1386890..1387636 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | NLV76_RS07280 | Protein ID | WP_024121090.1 |
Coordinates | 1386720..1386890 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLV76_RS07240 (NLV76_07240) | 1381738..1383570 | + | 1833 | WP_254503611.1 | terminase | - |
NLV76_RS07245 (NLV76_07245) | 1383582..1383912 | + | 331 | Protein_1364 | XkdW family protein | - |
NLV76_RS07250 (NLV76_07250) | 1383909..1384073 | + | 165 | WP_044156230.1 | XkdX family protein | - |
NLV76_RS07255 (NLV76_07255) | 1384117..1384956 | + | 840 | WP_254503220.1 | phage portal protein | - |
NLV76_RS07260 (NLV76_07260) | 1385012..1385281 | + | 270 | WP_059352787.1 | hemolysin XhlA family protein | - |
NLV76_RS07265 (NLV76_07265) | 1385293..1385556 | + | 264 | WP_059352788.1 | phage holin | - |
NLV76_RS07270 (NLV76_07270) | 1385569..1386462 | + | 894 | WP_254503221.1 | N-acetylmuramoyl-L-alanine amidase | - |
NLV76_RS07275 (NLV76_07275) | 1386499..1386636 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NLV76_RS07280 (NLV76_07280) | 1386720..1386890 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NLV76_RS07285 (NLV76_07285) | 1386890..1387636 | - | 747 | WP_024121091.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NLV76_RS07290 (NLV76_07290) | 1387746..1388747 | - | 1002 | WP_254503222.1 | inorganic phosphate transporter | - |
NLV76_RS07295 (NLV76_07295) | 1388760..1389377 | - | 618 | WP_254503223.1 | DUF47 domain-containing protein | - |
NLV76_RS07300 (NLV76_07300) | 1389653..1390969 | - | 1317 | WP_254503224.1 | serine/threonine exchanger | - |
NLV76_RS07305 (NLV76_07305) | 1391364..1392314 | + | 951 | WP_254503225.1 | ring-cleaving dioxygenase | - |
NLV76_RS07310 (NLV76_07310) | 1392480..1392560 | + | 81 | Protein_1377 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1353753..1396075 | 42322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29076.48 Da Isoelectric Point: 4.4986
>T251353 WP_024121091.1 NZ_CP100752:c1387636-1386890 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y3 |