Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 524005..524641 | Replicon | chromosome |
| Accession | NZ_CP100752 | ||
| Organism | Bacillus halotolerans strain MEC_B301 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NLV76_RS02705 | Protein ID | WP_003156187.1 |
| Coordinates | 524291..524641 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | NLV76_RS02700 | Protein ID | WP_003225183.1 |
| Coordinates | 524005..524286 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLV76_RS02680 (NLV76_02680) | 520362..520961 | - | 600 | WP_254502533.1 | rhomboid family intramembrane serine protease | - |
| NLV76_RS02685 (NLV76_02685) | 521056..521421 | + | 366 | WP_254502535.1 | holo-ACP synthase | - |
| NLV76_RS02690 (NLV76_02690) | 521587..522603 | + | 1017 | WP_082687822.1 | outer membrane lipoprotein carrier protein LolA | - |
| NLV76_RS02695 (NLV76_02695) | 522720..523904 | + | 1185 | WP_254502536.1 | alanine racemase | - |
| NLV76_RS02700 (NLV76_02700) | 524005..524286 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NLV76_RS02705 (NLV76_02705) | 524291..524641 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NLV76_RS02710 (NLV76_02710) | 524757..525581 | + | 825 | WP_254502537.1 | RsbT co-antagonist protein RsbRA | - |
| NLV76_RS02715 (NLV76_02715) | 525586..525951 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| NLV76_RS02720 (NLV76_02720) | 525955..526356 | + | 402 | WP_254502538.1 | serine/threonine-protein kinase RsbT | - |
| NLV76_RS02725 (NLV76_02725) | 526368..527375 | + | 1008 | WP_254502539.1 | phosphoserine phosphatase RsbU | - |
| NLV76_RS02730 (NLV76_02730) | 527436..527765 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
| NLV76_RS02735 (NLV76_02735) | 527762..528244 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
| NLV76_RS02740 (NLV76_02740) | 528210..528998 | + | 789 | WP_254502540.1 | RNA polymerase sigma factor SigB | - |
| NLV76_RS02745 (NLV76_02745) | 528998..529597 | + | 600 | WP_044161719.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T251352 WP_003156187.1 NZ_CP100752:524291-524641 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|