Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4041608..4042124 | Replicon | chromosome |
| Accession | NZ_CP100747 | ||
| Organism | Salmonella enterica subsp. enterica serovar Montevideo strain R17.4849 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | NL707_RS19735 | Protein ID | WP_000220578.1 |
| Coordinates | 4041608..4041892 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NL707_RS19740 | Protein ID | WP_000212724.1 |
| Coordinates | 4041882..4042124 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL707_RS19720 (4036724) | 4036724..4038376 | + | 1653 | WP_000154969.1 | alpha,alpha-phosphotrehalase | - |
| NL707_RS19725 (4038785) | 4038785..4040923 | + | 2139 | WP_000187815.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NL707_RS19730 (4041140) | 4041140..4041604 | + | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NL707_RS19735 (4041608) | 4041608..4041892 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL707_RS19740 (4041882) | 4041882..4042124 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NL707_RS19745 (4042202) | 4042202..4044115 | - | 1914 | WP_001212153.1 | BglG family transcription antiterminator | - |
| NL707_RS19750 (4044132) | 4044132..4044872 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
| NL707_RS19755 (4044869) | 4044869..4045987 | - | 1119 | WP_001139174.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NL707_RS19760 (4045971) | 4045971..4047104 | - | 1134 | WP_000459953.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T251348 WP_000220578.1 NZ_CP100747:c4041892-4041608 [Salmonella enterica subsp. enterica serovar Montevideo]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |