Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3986703..3987406 | Replicon | chromosome |
Accession | NZ_CP100747 | ||
Organism | Salmonella enterica subsp. enterica serovar Montevideo strain R17.4849 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A3V9YEG3 |
Locus tag | NL707_RS19490 | Protein ID | WP_000854678.1 |
Coordinates | 3986703..3987044 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A3V3HFF7 |
Locus tag | NL707_RS19495 | Protein ID | WP_000842921.1 |
Coordinates | 3987065..3987406 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL707_RS19475 (3982967) | 3982967..3983683 | + | 717 | WP_000532939.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
NL707_RS19480 (3984161) | 3984161..3985036 | - | 876 | WP_000199876.1 | HNH endonuclease | - |
NL707_RS19485 (3985437) | 3985437..3986426 | - | 990 | WP_077905735.1 | restriction endonuclease | - |
NL707_RS19490 (3986703) | 3986703..3987044 | - | 342 | WP_000854678.1 | TA system toxin CbtA family protein | Toxin |
NL707_RS19495 (3987065) | 3987065..3987406 | - | 342 | WP_000842921.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NL707_RS19500 (3987774) | 3987774..3990227 | + | 2454 | WP_000985297.1 | type I restriction-modification system subunit M | - |
NL707_RS19505 (3990242) | 3990242..3991603 | + | 1362 | WP_001043545.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3978155..4002698 | 24543 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12780.67 Da Isoelectric Point: 6.4593
>T251347 WP_000854678.1 NZ_CP100747:c3987044-3986703 [Salmonella enterica subsp. enterica serovar Montevideo]
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNYLVEKYELVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNYLVEKYELVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12882.63 Da Isoelectric Point: 6.6253
>AT251347 WP_000842921.1 NZ_CP100747:c3987406-3987065 [Salmonella enterica subsp. enterica serovar Montevideo]
MKSTDSENDLFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFINAEYLKLDEIFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSCGYVYIAVYPTQR
MKSTDSENDLFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFINAEYLKLDEIFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSCGYVYIAVYPTQR
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V9YEG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V3HFF7 |