Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3359743..3360363 | Replicon | chromosome |
| Accession | NZ_CP100747 | ||
| Organism | Salmonella enterica subsp. enterica serovar Montevideo strain R17.4849 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NL707_RS16630 | Protein ID | WP_001280991.1 |
| Coordinates | 3360145..3360363 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NL707_RS16625 | Protein ID | WP_000344807.1 |
| Coordinates | 3359743..3360117 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL707_RS16615 (3354882) | 3354882..3356075 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL707_RS16620 (3356098) | 3356098..3359247 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NL707_RS16625 (3359743) | 3359743..3360117 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NL707_RS16630 (3360145) | 3360145..3360363 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NL707_RS16635 (3360542) | 3360542..3361093 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
| NL707_RS16640 (3361211) | 3361211..3361681 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NL707_RS16645 (3361737) | 3361737..3361877 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NL707_RS16650 (3361883) | 3361883..3362143 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NL707_RS16655 (3362368) | 3362368..3363918 | + | 1551 | WP_000213134.1 | EAL domain-containing protein | - |
| NL707_RS16665 (3364149) | 3364149..3364538 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NL707_RS16670 (3364571) | 3364571..3365140 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251346 WP_001280991.1 NZ_CP100747:3360145-3360363 [Salmonella enterica subsp. enterica serovar Montevideo]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251346 WP_000344807.1 NZ_CP100747:3359743-3360117 [Salmonella enterica subsp. enterica serovar Montevideo]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|