Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 271019..271541 Replicon plasmid pR18.0234_299k
Accession NZ_CP100745
Organism Salmonella enterica subsp. enterica serovar Newport strain R18.0234

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag FGU68_RS24310 Protein ID WP_000220561.1
Coordinates 271260..271541 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag FGU68_RS24305 Protein ID WP_000121743.1
Coordinates 271019..271270 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGU68_RS24285 (FGU68_24285) 267794..267961 - 168 WP_228614010.1 hypothetical protein -
FGU68_RS24290 (FGU68_24290) 268282..268464 + 183 WP_042634467.1 hypothetical protein -
FGU68_RS24295 (FGU68_24295) 268498..269202 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
FGU68_RS24305 (FGU68_24305) 271019..271270 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
FGU68_RS24310 (FGU68_24310) 271260..271541 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
FGU68_RS24315 (FGU68_24315) 271780..271872 - 93 Protein_287 IS6 family transposase -
FGU68_RS24320 (FGU68_24320) 272038..273237 - 1200 WP_000948429.1 IS91 family transposase -
FGU68_RS24325 (FGU68_24325) 273247..273435 - 189 WP_000957857.1 hypothetical protein -
FGU68_RS24330 (FGU68_24330) 273555..274985 + 1431 Protein_290 IS4-like element IS50R family transposase -
FGU68_RS24335 (FGU68_24335) 275014..275808 + 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
FGU68_RS24340 (FGU68_24340) 275829..276065 + 237 Protein_292 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaTEM-1B / ant(3'')-Ia / lnu(F) / sul3 / qnrS1 / dfrA12 / aadA2 / qacE / sul1 / mph(A) / aac(3)-IVa / aph(4)-Ia / floR / aph(3')-IIa - 1..299493 299493
- inside IScluster/Tn aph(3')-IIa - 269283..278372 9089


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T251338 WP_000220561.1 NZ_CP100745:271260-271541 [Salmonella enterica subsp. enterica serovar Newport]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT251338 WP_000121743.1 NZ_CP100745:271019-271270 [Salmonella enterica subsp. enterica serovar Newport]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References