Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4221618..4222399 | Replicon | chromosome |
Accession | NZ_CP100744 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0234 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | FGU68_RS20505 | Protein ID | WP_000625912.1 |
Coordinates | 4221618..4222109 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | FGU68_RS20510 | Protein ID | WP_001110450.1 |
Coordinates | 4222106..4222399 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGU68_RS20480 (4218500) | 4218500..4219330 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
FGU68_RS20485 (4219574) | 4219574..4219744 | - | 171 | Protein_4003 | adhesin biosynthesis transcription regulatory family protein | - |
FGU68_RS20490 (4220368) | 4220368..4220511 | + | 144 | Protein_4004 | transposase | - |
FGU68_RS20495 (4220528) | 4220528..4220874 | + | 347 | Protein_4005 | Rpn family recombination-promoting nuclease/putative transposase | - |
FGU68_RS20500 (4221155) | 4221155..4221403 | - | 249 | Protein_4006 | IS481 family transposase | - |
FGU68_RS20505 (4221618) | 4221618..4222109 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
FGU68_RS20510 (4222106) | 4222106..4222399 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
FGU68_RS20515 (4222716) | 4222716..4222938 | + | 223 | Protein_4009 | hypothetical protein | - |
FGU68_RS20520 (4223202) | 4223202..4224077 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
FGU68_RS20525 (4224074) | 4224074..4224361 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
FGU68_RS20530 (4224354) | 4224354..4224536 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
FGU68_RS20535 (4224556) | 4224556..4224655 | + | 100 | Protein_4013 | hypothetical protein | - |
FGU68_RS20540 (4224772) | 4224772..4224906 | + | 135 | Protein_4014 | hypothetical protein | - |
FGU68_RS20545 (4225201) | 4225201..4226106 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4214706..4224361 | 9655 | |
- | inside | Genomic island | - | - | 4211012..4224536 | 13524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T251334 WP_000625912.1 NZ_CP100744:c4222109-4221618 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10949.56 Da Isoelectric Point: 8.6141
>AT251334 WP_001110450.1 NZ_CP100744:c4222399-4222106 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |