Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4104210..4104726 | Replicon | chromosome |
Accession | NZ_CP100744 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0234 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | FGU68_RS19865 | Protein ID | WP_000220578.1 |
Coordinates | 4104210..4104494 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | FGU68_RS19870 | Protein ID | WP_000212724.1 |
Coordinates | 4104484..4104726 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGU68_RS19850 (4099422) | 4099422..4101074 | + | 1653 | WP_000155045.1 | alpha,alpha-phosphotrehalase | - |
FGU68_RS19855 (4101483) | 4101483..4103621 | + | 2139 | WP_000187825.1 | anaerobic ribonucleoside-triphosphate reductase | - |
FGU68_RS19860 (4103742) | 4103742..4104206 | + | 465 | WP_001268864.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
FGU68_RS19865 (4104210) | 4104210..4104494 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGU68_RS19870 (4104484) | 4104484..4104726 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FGU68_RS19875 (4104804) | 4104804..4106717 | - | 1914 | WP_001212150.1 | BglG family transcription antiterminator | - |
FGU68_RS19880 (4106734) | 4106734..4107474 | - | 741 | WP_000779258.1 | KDGP aldolase family protein | - |
FGU68_RS19885 (4107471) | 4107471..4108589 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
FGU68_RS19890 (4108573) | 4108573..4109706 | - | 1134 | WP_000459939.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T251333 WP_000220578.1 NZ_CP100744:c4104494-4104210 [Salmonella enterica subsp. enterica serovar Newport]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |