Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3416251..3416871 | Replicon | chromosome |
Accession | NZ_CP100744 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0234 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | FGU68_RS16700 | Protein ID | WP_001280991.1 |
Coordinates | 3416653..3416871 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | FGU68_RS16695 | Protein ID | WP_000344807.1 |
Coordinates | 3416251..3416625 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGU68_RS16685 (3411390) | 3411390..3412583 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
FGU68_RS16690 (3412606) | 3412606..3415755 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
FGU68_RS16695 (3416251) | 3416251..3416625 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
FGU68_RS16700 (3416653) | 3416653..3416871 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
FGU68_RS16705 (3417050) | 3417050..3417601 | + | 552 | WP_001278794.1 | maltose O-acetyltransferase | - |
FGU68_RS16710 (3417718) | 3417718..3418188 | + | 471 | WP_000136181.1 | YlaC family protein | - |
FGU68_RS16715 (3418244) | 3418244..3418384 | - | 141 | WP_001197750.1 | type B 50S ribosomal protein L36 | - |
FGU68_RS16720 (3418390) | 3418390..3418650 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
FGU68_RS16725 (3418875) | 3418875..3420425 | + | 1551 | WP_000213146.1 | EAL domain-containing protein | - |
FGU68_RS16735 (3420656) | 3420656..3421045 | + | 390 | WP_000961287.1 | MGMT family protein | - |
FGU68_RS16740 (3421078) | 3421078..3421647 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251330 WP_001280991.1 NZ_CP100744:3416653-3416871 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251330 WP_000344807.1 NZ_CP100744:3416251-3416625 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|