Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1937..2496 | Replicon | plasmid pR18.0292_89k |
Accession | NZ_CP100741 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0292 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1PMX5 |
Locus tag | NL736_RS24395 | Protein ID | WP_000421257.1 |
Coordinates | 2221..2496 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A5I3EQ05 |
Locus tag | NL736_RS24390 | Protein ID | WP_001674495.1 |
Coordinates | 1937..2221 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL736_RS24385 (1) | 1..1032 | + | 1032 | WP_000907867.1 | plasmid replication initiator RepA | - |
NL736_RS24390 (1937) | 1937..2221 | + | 285 | WP_001674495.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NL736_RS24395 (2221) | 2221..2496 | + | 276 | WP_000421257.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL736_RS24400 (2751) | 2751..3002 | - | 252 | Protein_3 | hypothetical protein | - |
NL736_RS24405 (2965) | 2965..3939 | - | 975 | WP_012478345.1 | IS30-like element ISApl1 family transposase | - |
NL736_RS24410 (4118) | 4118..4720 | - | 603 | WP_094308828.1 | ProQ/FINO family protein | - |
NL736_RS24415 (4896) | 4896..5948 | - | 1053 | WP_000655519.1 | hypothetical protein | - |
NL736_RS24420 (6160) | 6160..6750 | - | 591 | WP_102000831.1 | hypothetical protein | - |
NL736_RS24425 (6750) | 6750..7007 | - | 258 | WP_094308825.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(42) | - | 1..88662 | 88662 | |
- | flank | IS/Tn | - | - | 2965..3888 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10749.45 Da Isoelectric Point: 9.9324
>T251321 WP_000421257.1 NZ_CP100741:2221-2496 [Salmonella enterica subsp. enterica serovar Typhimurium]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR
Download Length: 276 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10460.87 Da Isoelectric Point: 5.6558
>AT251321 WP_001674495.1 NZ_CP100741:1937-2221 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQMKNNSAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR
MQMKNNSAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PMX5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I3EQ05 |