Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4143356..4143872 | Replicon | chromosome |
Accession | NZ_CP100739 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0292 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | NL736_RS20130 | Protein ID | WP_000220578.1 |
Coordinates | 4143356..4143640 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NL736_RS20135 | Protein ID | WP_000212724.1 |
Coordinates | 4143630..4143872 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL736_RS20115 (4138568) | 4138568..4140220 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
NL736_RS20120 (4140629) | 4140629..4142767 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL736_RS20125 (4142888) | 4142888..4143352 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL736_RS20130 (4143356) | 4143356..4143640 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL736_RS20135 (4143630) | 4143630..4143872 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NL736_RS20140 (4143950) | 4143950..4145863 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
NL736_RS20145 (4145880) | 4145880..4146620 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
NL736_RS20150 (4146617) | 4146617..4147735 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NL736_RS20155 (4147719) | 4147719..4148852 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T251316 WP_000220578.1 NZ_CP100739:c4143640-4143356 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |