Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 250325..250847 | Replicon | plasmid pR18.1477_259k |
| Accession | NZ_CP100737 | ||
| Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.1477 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D0QMR1 |
| Locus tag | NL742_RS24550 | Protein ID | WP_000220561.1 |
| Coordinates | 250566..250847 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | NL742_RS24545 | Protein ID | WP_000121743.1 |
| Coordinates | 250325..250576 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL742_RS24525 (NL742_24525) | 247100..247267 | - | 168 | WP_228614010.1 | hypothetical protein | - |
| NL742_RS24530 (NL742_24530) | 247588..247770 | + | 183 | WP_042634467.1 | hypothetical protein | - |
| NL742_RS24535 (NL742_24535) | 247804..248508 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NL742_RS24545 (NL742_24545) | 250325..250576 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| NL742_RS24550 (NL742_24550) | 250566..250847 | + | 282 | WP_000220561.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL742_RS24555 (NL742_24555) | 251086..251178 | - | 93 | Protein_274 | IS6 family transposase | - |
| NL742_RS24560 (NL742_24560) | 251344..252543 | - | 1200 | WP_000948429.1 | IS91 family transposase | - |
| NL742_RS24565 (NL742_24565) | 252553..252741 | - | 189 | WP_000957857.1 | hypothetical protein | - |
| NL742_RS24570 (NL742_24570) | 252830..253885 | - | 1056 | WP_254522804.1 | DNA-binding protein | - |
| NL742_RS24575 (NL742_24575) | 254254..255066 | + | 813 | WP_042634270.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aph(3')-IIa / tet(A) / dfrA12 / aadA2 / qacE / sul1 / mph(A) / aac(3)-IVa / aph(4)-Ia / floR | - | 1..258626 | 258626 | |
| - | inside | IScluster/Tn | - | - | 248589..252543 | 3954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11023.86 Da Isoelectric Point: 10.5938
>T251300 WP_000220561.1 NZ_CP100737:250566-250847 [Salmonella enterica subsp. enterica serovar Agona]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I302 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |