Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 250325..250847 Replicon plasmid pR18.1477_259k
Accession NZ_CP100737
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.1477

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag NL742_RS24550 Protein ID WP_000220561.1
Coordinates 250566..250847 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NL742_RS24545 Protein ID WP_000121743.1
Coordinates 250325..250576 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL742_RS24525 (NL742_24525) 247100..247267 - 168 WP_228614010.1 hypothetical protein -
NL742_RS24530 (NL742_24530) 247588..247770 + 183 WP_042634467.1 hypothetical protein -
NL742_RS24535 (NL742_24535) 247804..248508 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NL742_RS24545 (NL742_24545) 250325..250576 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NL742_RS24550 (NL742_24550) 250566..250847 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL742_RS24555 (NL742_24555) 251086..251178 - 93 Protein_274 IS6 family transposase -
NL742_RS24560 (NL742_24560) 251344..252543 - 1200 WP_000948429.1 IS91 family transposase -
NL742_RS24565 (NL742_24565) 252553..252741 - 189 WP_000957857.1 hypothetical protein -
NL742_RS24570 (NL742_24570) 252830..253885 - 1056 WP_254522804.1 DNA-binding protein -
NL742_RS24575 (NL742_24575) 254254..255066 + 813 WP_042634270.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aph(3')-IIa / tet(A) / dfrA12 / aadA2 / qacE / sul1 / mph(A) / aac(3)-IVa / aph(4)-Ia / floR - 1..258626 258626
- inside IScluster/Tn - - 248589..252543 3954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T251300 WP_000220561.1 NZ_CP100737:250566-250847 [Salmonella enterica subsp. enterica serovar Agona]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT251300 WP_000121743.1 NZ_CP100737:250325-250576 [Salmonella enterica subsp. enterica serovar Agona]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References