Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4111636..4112279 | Replicon | chromosome |
Accession | NZ_CP100736 | ||
Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.1477 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | NL742_RS19815 | Protein ID | WP_000048134.1 |
Coordinates | 4111863..4112279 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | NL742_RS19810 | Protein ID | WP_001261294.1 |
Coordinates | 4111636..4111866 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL742_RS19800 (4108650) | 4108650..4110788 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL742_RS19805 (4111005) | 4111005..4111469 | + | 465 | WP_001009177.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL742_RS19810 (4111636) | 4111636..4111866 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NL742_RS19815 (4111863) | 4111863..4112279 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NL742_RS19820 (4112340) | 4112340..4114253 | - | 1914 | WP_001212127.1 | BglG family transcription antiterminator | - |
NL742_RS19825 (4114270) | 4114270..4115010 | - | 741 | WP_000779249.1 | KDGP aldolase family protein | - |
NL742_RS19830 (4115007) | 4115007..4116125 | - | 1119 | WP_001139179.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NL742_RS19835 (4116109) | 4116109..4117242 | - | 1134 | WP_000459942.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T251296 WP_000048134.1 NZ_CP100736:4111863-4112279 [Salmonella enterica subsp. enterica serovar Agona]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |