Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4058082..4058632 Replicon chromosome
Accession NZ_CP100736
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.1477

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag NL742_RS19530 Protein ID WP_001199743.1
Coordinates 4058082..4058390 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag NL742_RS19535 Protein ID WP_000016244.1
Coordinates 4058393..4058632 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL742_RS19510 (4053127) 4053127..4053582 + 456 WP_031602458.1 NUDIX domain-containing protein -
NL742_RS19515 (4053873) 4053873..4055485 + 1613 Protein_3817 TraI domain-containing protein -
NL742_RS19520 (4055475) 4055475..4056401 + 927 WP_000142420.1 site-specific integrase -
NL742_RS19530 (4058082) 4058082..4058390 - 309 WP_001199743.1 CcdB family protein Toxin
NL742_RS19535 (4058393) 4058393..4058632 - 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NL742_RS19540 (4058741) 4058741..4058989 - 249 WP_000254751.1 ribbon-helix-helix domain-containing protein -
NL742_RS19545 (4059180) 4059180..4059611 - 432 Protein_3823 helix-turn-helix domain-containing protein -
NL742_RS19550 (4060291) 4060291..4062924 - 2634 WP_001280979.1 phage tail tape measure protein -
NL742_RS19555 (4062917) 4062917..4063036 - 120 WP_001747644.1 GpE family phage tail protein -
NL742_RS19560 (4063051) 4063051..4063362 - 312 WP_001292737.1 phage tail assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage fosA7 - 4028203..4072068 43865
- inside IScluster/Tn - - 4056447..4059566 3119


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T251295 WP_001199743.1 NZ_CP100736:c4058390-4058082 [Salmonella enterica subsp. enterica serovar Agona]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT251295 WP_000016244.1 NZ_CP100736:c4058632-4058393 [Salmonella enterica subsp. enterica serovar Agona]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References