Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3428408..3429028 | Replicon | chromosome |
| Accession | NZ_CP100736 | ||
| Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.1477 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NL742_RS16615 | Protein ID | WP_001280991.1 |
| Coordinates | 3428810..3429028 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NL742_RS16610 | Protein ID | WP_000344807.1 |
| Coordinates | 3428408..3428782 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL742_RS16600 (3423547) | 3423547..3424740 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL742_RS16605 (3424763) | 3424763..3427912 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NL742_RS16610 (3428408) | 3428408..3428782 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NL742_RS16615 (3428810) | 3428810..3429028 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NL742_RS16620 (3429207) | 3429207..3429758 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NL742_RS16625 (3429876) | 3429876..3430346 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NL742_RS16630 (3430402) | 3430402..3430542 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NL742_RS16635 (3430548) | 3430548..3430808 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NL742_RS16640 (3431033) | 3431033..3432583 | + | 1551 | WP_000213148.1 | EAL domain-containing protein | - |
| NL742_RS16650 (3432814) | 3432814..3433203 | + | 390 | WP_000961286.1 | MGMT family protein | - |
| NL742_RS16655 (3433236) | 3433236..3433805 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251291 WP_001280991.1 NZ_CP100736:3428810-3429028 [Salmonella enterica subsp. enterica serovar Agona]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251291 WP_000344807.1 NZ_CP100736:3428408-3428782 [Salmonella enterica subsp. enterica serovar Agona]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|