Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 2352513..2353035 Replicon chromosome
Accession NZ_CP100736
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.1477

Toxin (Protein)


Gene name stbE Uniprot ID B5F5Y5
Locus tag NL742_RS11400 Protein ID WP_000221343.1
Coordinates 2352513..2352797 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID V1H457
Locus tag NL742_RS11405 Protein ID WP_000885424.1
Coordinates 2352787..2353035 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL742_RS11380 (2348588) 2348588..2350096 - 1509 WP_000199409.1 FAD-dependent oxidoreductase -
NL742_RS11385 (2350141) 2350141..2350629 + 489 WP_001293635.1 MarR family winged helix-turn-helix transcriptional regulator -
NL742_RS11390 (2350822) 2350822..2351901 + 1080 WP_000954697.1 S-adenosylmethionine:tRNA ribosyltransferase-isomerase -
NL742_RS11395 (2351953) 2351953..2352342 - 390 WP_000194089.1 RidA family protein -
NL742_RS11400 (2352513) 2352513..2352797 - 285 WP_000221343.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL742_RS11405 (2352787) 2352787..2353035 - 249 WP_000885424.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL742_RS11410 (2353448) 2353448..2353801 - 354 WP_000418733.1 hypothetical protein -
NL742_RS11415 (2353804) 2353804..2354193 - 390 WP_001044696.1 hypothetical protein -
NL742_RS11420 (2354558) 2354558..2354665 + 108 Protein_2235 IS110 family transposase -
NL742_RS11425 (2355081) 2355081..2355413 + 333 WP_000253156.1 DUF1493 family protein -
NL742_RS11430 (2355688) 2355688..2355876 - 189 WP_001276021.1 DUF29 family protein -
NL742_RS11435 (2356289) 2356289..2357197 + 909 WP_001176641.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2350822..2360069 9247


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11075.85 Da        Isoelectric Point: 10.6500

>T251285 WP_000221343.1 NZ_CP100736:c2352797-2352513 [Salmonella enterica subsp. enterica serovar Agona]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9090.32 Da        Isoelectric Point: 3.9820

>AT251285 WP_000885424.1 NZ_CP100736:c2353035-2352787 [Salmonella enterica subsp. enterica serovar Agona]
MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERANERVIEVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H5JSW4

Antitoxin

Source ID Structure
AlphaFold DB A0A5I0WPN5

References