Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 853304..853964 | Replicon | chromosome |
Accession | NZ_CP100736 | ||
Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.1477 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NL742_RS04150 | Protein ID | WP_000244756.1 |
Coordinates | 853551..853964 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NL742_RS04145 | Protein ID | WP_000351186.1 |
Coordinates | 853304..853570 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL742_RS04125 (849232) | 849232..850665 | - | 1434 | WP_001230139.1 | 6-phospho-beta-glucosidase BglA | - |
NL742_RS04130 (850824) | 850824..851138 | + | 315 | WP_001182977.1 | N(4)-acetylcytidine aminohydrolase | - |
NL742_RS04135 (851299) | 851299..851958 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
NL742_RS04140 (852074) | 852074..853054 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
NL742_RS04145 (853304) | 853304..853570 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NL742_RS04150 (853551) | 853551..853964 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
NL742_RS04155 (854017) | 854017..854538 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
NL742_RS04160 (854651) | 854651..855547 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NL742_RS04165 (855571) | 855571..856284 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL742_RS04170 (856290) | 856290..858023 | + | 1734 | WP_000813397.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T251283 WP_000244756.1 NZ_CP100736:853551-853964 [Salmonella enterica subsp. enterica serovar Agona]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |