Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 1940..2499 | Replicon | plasmid pR18.1932_88k |
| Accession | NZ_CP100734 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.1932 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NL737_RS24180 | Protein ID | WP_254520619.1 |
| Coordinates | 2224..2499 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C1J8K5 |
| Locus tag | NL737_RS24175 | Protein ID | WP_001178089.1 |
| Coordinates | 1940..2224 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL737_RS24170 (1) | 1..1032 | + | 1032 | WP_254520618.1 | plasmid replication initiator RepA | - |
| NL737_RS24175 (1940) | 1940..2224 | + | 285 | WP_001178089.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NL737_RS24180 (2224) | 2224..2499 | + | 276 | WP_254520619.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL737_RS24185 (2605) | 2605..2883 | + | 279 | WP_001105069.1 | hypothetical protein | - |
| NL737_RS24190 (3078) | 3078..3344 | - | 267 | WP_000627829.1 | hypothetical protein | - |
| NL737_RS24195 (3344) | 3344..3838 | - | 495 | WP_001582574.1 | hypothetical protein | - |
| NL737_RS24200 (3894) | 3894..4496 | - | 603 | WP_000517695.1 | ProQ/FINO family protein | - |
| NL737_RS24205 (4850) | 4850..6196 | + | 1347 | WP_001132032.1 | protein YagA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..87844 | 87844 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10819.54 Da Isoelectric Point: 9.5296
>T251277 WP_254520619.1 NZ_CP100734:2224-2499 [Salmonella enterica subsp. enterica serovar Typhimurium]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNDQTIY
VLRLWHIRENR
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNDQTIY
VLRLWHIRENR
Download Length: 276 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10474.89 Da Isoelectric Point: 5.6558
>AT251277 WP_001178089.1 NZ_CP100734:1940-2224 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|