Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3405731..3406351 | Replicon | chromosome |
Accession | NZ_CP100732 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.1932 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL737_RS16615 | Protein ID | WP_001280991.1 |
Coordinates | 3406133..3406351 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL737_RS16610 | Protein ID | WP_000344807.1 |
Coordinates | 3405731..3406105 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL737_RS16600 (3400870) | 3400870..3402063 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL737_RS16605 (3402086) | 3402086..3405235 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL737_RS16610 (3405731) | 3405731..3406105 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL737_RS16615 (3406133) | 3406133..3406351 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL737_RS16620 (3406530) | 3406530..3407081 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NL737_RS16625 (3407198) | 3407198..3407668 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NL737_RS16630 (3407724) | 3407724..3407864 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL737_RS16635 (3407870) | 3407870..3408130 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL737_RS16640 (3408355) | 3408355..3409905 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL737_RS16650 (3410136) | 3410136..3410525 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL737_RS16655 (3410558) | 3410558..3411127 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251268 WP_001280991.1 NZ_CP100732:3406133-3406351 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251268 WP_000344807.1 NZ_CP100732:3405731-3406105 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|