Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 40309..40910 | Replicon | plasmid pR17.0776_84k |
| Accession | NZ_CP100729 | ||
| Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NL731_RS24410 | Protein ID | WP_247780674.1 |
| Coordinates | 40530..40910 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A3P5HIB7 |
| Locus tag | NL731_RS24405 | Protein ID | WP_001190709.1 |
| Coordinates | 40309..40530 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL731_RS24355 (NL731_24355) | 35385..36065 | + | 681 | WP_247779487.1 | hypothetical protein | - |
| NL731_RS24360 (NL731_24360) | 36075..36947 | + | 873 | WP_137441762.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| NL731_RS24365 (NL731_24365) | 36944..37420 | + | 477 | WP_196114205.1 | hypothetical protein | - |
| NL731_RS24370 (NL731_24370) | 37422..37949 | + | 528 | WP_254520892.1 | DUF551 domain-containing protein | - |
| NL731_RS24375 (NL731_24375) | 37942..38223 | + | 282 | WP_114447226.1 | ASCH domain-containing protein | - |
| NL731_RS24380 (NL731_24380) | 38247..38540 | + | 294 | WP_000267996.1 | hypothetical protein | - |
| NL731_RS24385 (NL731_24385) | 38565..38774 | + | 210 | WP_000206673.1 | hypothetical protein | - |
| NL731_RS24390 (NL731_24390) | 38771..39520 | + | 750 | WP_223598020.1 | hypothetical protein | - |
| NL731_RS24395 (NL731_24395) | 39504..39803 | + | 300 | WP_223598021.1 | antitoxin PHD | - |
| NL731_RS24400 (NL731_24400) | 39847..40236 | + | 390 | WP_000506727.1 | S24 family peptidase | - |
| NL731_RS24405 (NL731_24405) | 40309..40530 | + | 222 | WP_001190709.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL731_RS24410 (NL731_24410) | 40530..40910 | + | 381 | WP_247780674.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NL731_RS24415 (NL731_24415) | 40915..41112 | + | 198 | WP_223598022.1 | PdcA protein | - |
| NL731_RS24420 (NL731_24420) | 41145..41921 | - | 777 | WP_223598023.1 | hypothetical protein | - |
| NL731_RS24425 (NL731_24425) | 41928..42605 | - | 678 | WP_223598024.1 | DUF2829 domain-containing protein | - |
| NL731_RS24430 (NL731_24430) | 42620..43114 | - | 495 | WP_165474253.1 | dUTP diphosphatase | - |
| NL731_RS24435 (NL731_24435) | 43111..43587 | - | 477 | WP_127678783.1 | hypothetical protein | - |
| NL731_RS24440 (NL731_24440) | 43584..43928 | - | 345 | WP_215417653.1 | hypothetical protein | - |
| NL731_RS24445 (NL731_24445) | 44002..45030 | - | 1029 | WP_001292231.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | floR | - | 1..83642 | 83642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13502.20 Da Isoelectric Point: 5.6343
>T251256 WP_247780674.1 NZ_CP100729:40530-40910 [Salmonella enterica subsp. enterica serovar Blockley]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEASATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELAGLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEASATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELAGLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|