Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4246626..4247142 | Replicon | chromosome |
Accession | NZ_CP100728 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I6CHB9 |
Locus tag | NL731_RS20850 | Protein ID | WP_000220581.1 |
Coordinates | 4246626..4246910 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NL731_RS20855 | Protein ID | WP_000212724.1 |
Coordinates | 4246900..4247142 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL731_RS20835 (4241837) | 4241837..4243489 | + | 1653 | WP_064047086.1 | alpha,alpha-phosphotrehalase | - |
NL731_RS20840 (4243898) | 4243898..4246036 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL731_RS20845 (4246158) | 4246158..4246622 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL731_RS20850 (4246626) | 4246626..4246910 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL731_RS20855 (4246900) | 4246900..4247142 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NL731_RS20860 (4247220) | 4247220..4249133 | - | 1914 | WP_064047085.1 | BglG family transcription antiterminator | - |
NL731_RS20865 (4249150) | 4249150..4249890 | - | 741 | WP_064047084.1 | KDGP aldolase family protein | - |
NL731_RS20870 (4249887) | 4249887..4251005 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NL731_RS20875 (4250989) | 4250989..4252122 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T251252 WP_000220581.1 NZ_CP100728:c4246910-4246626 [Salmonella enterica subsp. enterica serovar Blockley]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I6CHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |