Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3547961..3548581 | Replicon | chromosome |
Accession | NZ_CP100728 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL731_RS17625 | Protein ID | WP_001280991.1 |
Coordinates | 3548363..3548581 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL731_RS17620 | Protein ID | WP_000344807.1 |
Coordinates | 3547961..3548335 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL731_RS17610 (3543100) | 3543100..3544293 | + | 1194 | WP_001039200.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL731_RS17615 (3544316) | 3544316..3547465 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL731_RS17620 (3547961) | 3547961..3548335 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL731_RS17625 (3548363) | 3548363..3548581 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL731_RS17630 (3548759) | 3548759..3549310 | + | 552 | WP_064047028.1 | maltose O-acetyltransferase | - |
NL731_RS17635 (3549427) | 3549427..3549897 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NL731_RS17640 (3549953) | 3549953..3550093 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL731_RS17645 (3550099) | 3550099..3550359 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL731_RS17650 (3550584) | 3550584..3552134 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL731_RS17660 (3552365) | 3552365..3552754 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL731_RS17665 (3552809) | 3552809..3553378 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251248 WP_001280991.1 NZ_CP100728:3548363-3548581 [Salmonella enterica subsp. enterica serovar Blockley]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251248 WP_000344807.1 NZ_CP100728:3547961-3548335 [Salmonella enterica subsp. enterica serovar Blockley]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|