Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2409487..2410009 | Replicon | chromosome |
| Accession | NZ_CP100728 | ||
| Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | NL731_RS11725 | Protein ID | WP_000221345.1 |
| Coordinates | 2409725..2410009 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NL731_RS11720 | Protein ID | WP_000885424.1 |
| Coordinates | 2409487..2409735 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL731_RS11690 (2405024) | 2405024..2406031 | - | 1008 | WP_000201082.1 | LacI family DNA-binding transcriptional regulator | - |
| NL731_RS11695 (2406289) | 2406289..2406471 | + | 183 | Protein_2289 | hypothetical protein | - |
| NL731_RS11700 (2406819) | 2406819..2407554 | + | 736 | Protein_2290 | helix-turn-helix domain-containing protein | - |
| NL731_RS11705 (2407610) | 2407610..2408518 | - | 909 | WP_077946216.1 | hypothetical protein | - |
| NL731_RS11710 (2408798) | 2408798..2409130 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
| NL731_RS11715 (2409120) | 2409120..2409335 | - | 216 | WP_000206207.1 | hypothetical protein | - |
| NL731_RS11720 (2409487) | 2409487..2409735 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL731_RS11725 (2409725) | 2409725..2410009 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL731_RS11730 (2410180) | 2410180..2410569 | + | 390 | WP_012218813.1 | RidA family protein | - |
| NL731_RS11735 (2410621) | 2410621..2411700 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NL731_RS11740 (2411893) | 2411893..2412381 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NL731_RS11745 (2412426) | 2412426..2413934 | + | 1509 | WP_000199415.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2406292..2416791 | 10499 | |
| - | flank | IS/Tn | - | - | 2406819..2407388 | 569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T251247 WP_000221345.1 NZ_CP100728:2409725-2410009 [Salmonella enterica subsp. enterica serovar Blockley]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |