Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1041333..1042147 | Replicon | chromosome |
Accession | NZ_CP100728 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R17.0776 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A627ECG4 |
Locus tag | NL731_RS05020 | Protein ID | WP_064047347.1 |
Coordinates | 1041333..1041860 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NL731_RS05025 | Protein ID | WP_000855694.1 |
Coordinates | 1041857..1042147 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL731_RS04990 (1037633) | 1037633..1038031 | + | 399 | Protein_979 | cytoplasmic protein | - |
NL731_RS04995 (1038222) | 1038222..1038461 | + | 240 | Protein_980 | hypothetical protein | - |
NL731_RS05000 (1038618) | 1038618..1039286 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NL731_RS05005 (1039313) | 1039313..1039807 | + | 495 | WP_000424947.1 | hypothetical protein | - |
NL731_RS05010 (1040052) | 1040052..1040708 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NL731_RS05015 (1041037) | 1041037..1041260 | + | 224 | Protein_984 | IS5/IS1182 family transposase | - |
NL731_RS05020 (1041333) | 1041333..1041860 | - | 528 | WP_064047347.1 | GNAT family N-acetyltransferase | Toxin |
NL731_RS05025 (1041857) | 1041857..1042147 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NL731_RS05030 (1042417) | 1042417..1042606 | - | 190 | Protein_987 | IS3 family transposase | - |
NL731_RS05035 (1042847) | 1042847..1043173 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NL731_RS05040 (1043446) | 1043446..1043793 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NL731_RS05045 (1043778) | 1043778..1044227 | - | 450 | WP_000381612.1 | membrane protein | - |
NL731_RS05050 (1044659) | 1044659..1045102 | - | 444 | WP_001522905.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NL731_RS05055 (1045558) | 1045558..1046208 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1041084..1041260 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19171.01 Da Isoelectric Point: 9.6420
>T251242 WP_064047347.1 NZ_CP100728:c1041860-1041333 [Salmonella enterica subsp. enterica serovar Blockley]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLWRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLWRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT251242 WP_000855694.1 NZ_CP100728:c1042147-1041857 [Salmonella enterica subsp. enterica serovar Blockley]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A627ECG4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |