Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 349953..350554 Replicon chromosome
Accession NZ_CP100728
Organism Salmonella enterica subsp. enterica serovar Blockley strain R17.0776

Toxin (Protein)


Gene name doc Uniprot ID A0A5U0JPI4
Locus tag NL731_RS01635 Protein ID WP_024166788.1
Coordinates 349953..350333 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A5T4YUW9
Locus tag NL731_RS01640 Protein ID WP_033545779.1
Coordinates 350333..350554 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL731_RS01615 (345306) 345306..346505 + 1200 WP_000804064.1 tetracycline efflux MFS transporter Tet(A) -
NL731_RS01620 (346537) 346537..347421 - 885 WP_000058717.1 EamA family transporter -
NL731_RS01625 (347559) 347559..347951 - 393 WP_079949553.1 isochorismatase family cysteine hydrolase -
NL731_RS01630 (347955) 347955..349706 + 1752 Protein_322 Tn3-like element TnAs1 family transposase -
NL731_RS01635 (349953) 349953..350333 - 381 WP_024166788.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL731_RS01640 (350333) 350333..350554 - 222 WP_033545779.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NL731_RS01645 (350627) 350627..351019 - 393 WP_000506718.1 S24 family peptidase -
NL731_RS01650 (351131) 351131..351379 - 249 WP_001286530.1 DNA polymerase III subunit theta -
NL731_RS01655 (351382) 351382..351582 - 201 WP_001408980.1 hypothetical protein -
NL731_RS01660 (351717) 351717..352007 - 291 WP_048659782.1 hypothetical protein -
NL731_RS01665 (352135) 352135..352839 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NL731_RS01670 (352892) 352892..353230 + 339 Protein_330 Tn3 family transposase -
NL731_RS01675 (353267) 353267..354175 + 909 WP_000174819.1 C45 family peptidase -
NL731_RS01680 (354329) 354329..355144 - 816 WP_000018321.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
NL731_RS01685 (355281) 355281..355394 + 114 Protein_333 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage aph(3')-Ia / aph(6)-Id / aph(3'')-Ib - 346537..360802 14265
- inside IScluster/Tn mph(A) / tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib - 338729..360802 22073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13663.58 Da        Isoelectric Point: 5.6406

>T251238 WP_024166788.1 NZ_CP100728:c350333-349953 [Salmonella enterica subsp. enterica serovar Blockley]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8147.13 Da        Isoelectric Point: 4.7708

>AT251238 WP_033545779.1 NZ_CP100728:c350554-350333 [Salmonella enterica subsp. enterica serovar Blockley]
MQSINFRTARGNLTEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5U0JPI4

Antitoxin

Source ID Structure
AlphaFold DB A0A5T4YUW9

References