251236

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 17580..18105 Replicon plasmid pR17.1476_64k
Accession NZ_CP100725
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag NL714_RS23380 Protein ID WP_001159863.1
Coordinates 17800..18105 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag NL714_RS23375 Protein ID WP_000813641.1
Coordinates 17580..17798 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL714_RS23345 (NL714_23345) 13194..13580 + 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -
NL714_RS23350 (NL714_23350) 13633..13752 + 120 Protein_17 recombinase -
NL714_RS23355 (NL714_23355) 14121..15110 - 990 WP_000461382.1 RepB family plasmid replication initiator protein -
NL714_RS23360 (NL714_23360) 15604..15899 - 296 Protein_19 cytoplasmic protein -
NL714_RS23365 (NL714_23365) 15911..16339 + 429 Protein_20 hypothetical protein -
NL714_RS23370 (NL714_23370) 16383..16904 - 522 WP_077681952.1 hypothetical protein -
NL714_RS23375 (NL714_23375) 17580..17798 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NL714_RS23380 (NL714_23380) 17800..18105 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
NL714_RS23385 (NL714_23385) 18107..18397 + 291 WP_001266176.1 hypothetical protein -
NL714_RS23390 (NL714_23390) 18394..18915 + 522 WP_000198608.1 hypothetical protein -
NL714_RS23395 (NL714_23395) 18950..19732 + 783 WP_000082169.1 site-specific integrase -
NL714_RS23400 (NL714_23400) 19741..20454 + 714 WP_000545756.1 EAL domain-containing protein -
NL714_RS23405 (NL714_23405) 20479..20967 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
NL714_RS23410 (NL714_23410) 20961..21446 + 486 WP_000905606.1 membrane protein -
NL714_RS23415 (NL714_23415) 21723..22010 - 288 WP_071530243.1 hypothetical protein -
NL714_RS23420 (NL714_23420) 22166..22726 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB 1..64326 64326


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T251236 WP_001159863.1 NZ_CP100725:17800-18105 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT251236 WP_000813641.1 NZ_CP100725:17580-17798 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References