Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4219277..4220058 | Replicon | chromosome |
Accession | NZ_CP100724 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | NL714_RS20735 | Protein ID | WP_000626100.1 |
Coordinates | 4219277..4219768 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NL714_RS20740 | Protein ID | WP_001110452.1 |
Coordinates | 4219765..4220058 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL714_RS20700 (4214737) | 4214737..4215084 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
NL714_RS20705 (4215060) | 4215060..4216763 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
NL714_RS20710 (4216800) | 4216800..4217375 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NL714_RS20720 (4217646) | 4217646..4217720 | - | 75 | Protein_4050 | helix-turn-helix domain-containing protein | - |
NL714_RS20725 (4218100) | 4218100..4218177 | + | 78 | Protein_4051 | porin family protein | - |
NL714_RS20730 (4218277) | 4218277..4219029 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
NL714_RS20735 (4219277) | 4219277..4219768 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
NL714_RS20740 (4219765) | 4219765..4220058 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NL714_RS20745 (4220375) | 4220375..4220596 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NL714_RS20750 (4220862) | 4220862..4221737 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
NL714_RS20755 (4221734) | 4221734..4222021 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
NL714_RS20760 (4222014) | 4222014..4222196 | - | 183 | WP_001676222.1 | ATP-binding cassette domain-containing protein | - |
NL714_RS20765 (4222321) | 4222321..4222569 | + | 249 | Protein_4059 | Ig-like domain-containing protein | - |
NL714_RS20770 (4222681) | 4222681..4222812 | + | 132 | Protein_4060 | hypothetical protein | - |
NL714_RS20775 (4223106) | 4223106..4224011 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T251233 WP_000626100.1 NZ_CP100724:c4219768-4219277 [Salmonella enterica subsp. enterica serovar Enteritidis]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT251233 WP_001110452.1 NZ_CP100724:c4220058-4219765 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1DGA4 |