Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4071256..4071806 Replicon chromosome
Accession NZ_CP100724
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag NL714_RS19950 Protein ID WP_001199743.1
Coordinates 4071256..4071564 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag NL714_RS19955 Protein ID WP_001118105.1
Coordinates 4071567..4071806 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL714_RS19930 (4067830) 4067830..4068570 - 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -
NL714_RS19935 (4068692) 4068692..4069222 - 531 WP_000909461.1 SEF14 fimbria major subunit SefA -
NL714_RS19940 (4069545) 4069545..4070678 + 1134 Protein_3899 IS3 family transposase -
NL714_RS19945 (4070710) 4070710..4070850 - 141 Protein_3900 Arm DNA-binding domain-containing protein -
NL714_RS19950 (4071256) 4071256..4071564 - 309 WP_001199743.1 CcdB family protein Toxin
NL714_RS19955 (4071567) 4071567..4071806 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NL714_RS19960 (4071915) 4071915..4072163 - 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
NL714_RS19965 (4072354) 4072354..4072785 - 432 Protein_3904 helix-turn-helix domain-containing protein -
NL714_RS19975 (4073542) 4073542..4074561 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
NL714_RS19980 (4074589) 4074589..4075119 - 531 WP_000896758.1 gluconokinase -
NL714_RS19985 (4075336) 4075336..4076367 + 1032 WP_000453347.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4069637..4072740 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T251231 WP_001199743.1 NZ_CP100724:c4071564-4071256 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT251231 WP_001118105.1 NZ_CP100724:c4071806-4071567 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References