Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3451473..3452093 | Replicon | chromosome |
| Accession | NZ_CP100724 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NL714_RS17090 | Protein ID | WP_001280991.1 |
| Coordinates | 3451875..3452093 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NL714_RS17085 | Protein ID | WP_000344807.1 |
| Coordinates | 3451473..3451847 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL714_RS17075 (3446612) | 3446612..3447805 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL714_RS17080 (3447828) | 3447828..3450977 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NL714_RS17085 (3451473) | 3451473..3451847 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NL714_RS17090 (3451875) | 3451875..3452093 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NL714_RS17095 (3452272) | 3452272..3452823 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NL714_RS17100 (3452941) | 3452941..3453411 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NL714_RS17105 (3453467) | 3453467..3453607 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NL714_RS17110 (3453613) | 3453613..3453873 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NL714_RS17115 (3454098) | 3454098..3455648 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| NL714_RS17125 (3455879) | 3455879..3456268 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| NL714_RS17130 (3456301) | 3456301..3456870 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251227 WP_001280991.1 NZ_CP100724:3451875-3452093 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251227 WP_000344807.1 NZ_CP100724:3451473-3451847 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|