Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310321..310907 Replicon chromosome
Accession NZ_CP100724
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain R17.1476

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag NL714_RS01415 Protein ID WP_000174964.1
Coordinates 310539..310907 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag NL714_RS01410 Protein ID WP_001522145.1
Coordinates 310321..310542 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL714_RS01385 (305327) 305327..306436 + 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NL714_RS01390 (306496) 306496..307422 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL714_RS01395 (307419) 307419..308711 + 1293 WP_254535368.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
NL714_RS01400 (308708) 308708..309475 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL714_RS01405 (309477) 309477..310190 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL714_RS01410 (310321) 310321..310542 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL714_RS01415 (310539) 310539..310907 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL714_RS01420 (311166) 311166..312482 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL714_RS01425 (312587) 312587..313474 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL714_RS01430 (313471) 313471..314316 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL714_RS01435 (314318) 314318..315388 + 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307419..316125 8706
- inside Prophage - - 300086..316125 16039


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T251216 WP_000174964.1 NZ_CP100724:310539-310907 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT251216 WP_001522145.1 NZ_CP100724:310321-310542 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References