Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 8434..8960 | Replicon | plasmid pR17.4942_71k |
Accession | NZ_CP100720 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NL732_RS24595 | Protein ID | WP_000323025.1 |
Coordinates | 8673..8960 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q5J3S4 |
Locus tag | NL732_RS24590 | Protein ID | WP_000534857.1 |
Coordinates | 8434..8673 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS24560 (NL732_24560) | 3602..4561 | + | 960 | WP_000208728.1 | DUF523 and DUF1722 domain-containing protein | - |
NL732_RS24565 (NL732_24565) | 4707..5795 | + | 1089 | WP_000633445.1 | AAA family ATPase | - |
NL732_RS24570 (NL732_24570) | 5858..6562 | - | 705 | WP_001067852.1 | IS6-like element IS26 family transposase | - |
NL732_RS24575 (NL732_24575) | 6826..7899 | - | 1074 | WP_000557466.1 | hypothetical protein | - |
NL732_RS24580 (NL732_24580) | 7943..8092 | - | 150 | WP_000550473.1 | hypothetical protein | - |
NL732_RS24585 (NL732_24585) | 8299..8409 | - | 111 | Protein_9 | hypothetical protein | - |
NL732_RS24590 (NL732_24590) | 8434..8673 | + | 240 | WP_000534857.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NL732_RS24595 (NL732_24595) | 8673..8960 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NL732_RS24600 (NL732_24600) | 9264..10046 | - | 783 | Protein_12 | IS21-like element ISSen3 family helper ATPase IstB | - |
NL732_RS24605 (NL732_24605) | 10043..11065 | - | 1023 | WP_000627495.1 | IS21-like element ISSen3 family transposase | - |
NL732_RS24610 (NL732_24610) | 11204..11428 | + | 225 | Protein_14 | hypothetical protein | - |
NL732_RS24615 (NL732_24615) | 11865..13145 | + | 1281 | WP_254521384.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) / mph(A) / sul1 / qacE / aadA2 / dfrA12 / sul2 | - | 1..71243 | 71243 | |
- | inside | IScluster/Tn | tet(A) | - | 5858..21890 | 16032 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T251214 WP_000323025.1 NZ_CP100720:8673-8960 [Salmonella enterica subsp. enterica serovar Weltevreden]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|