Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 45516..46041 | Replicon | plasmid pR17.4942_82k |
Accession | NZ_CP100719 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A4V6H280 |
Locus tag | NL732_RS24310 | Protein ID | WP_001159862.1 |
Coordinates | 45736..46041 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A4U8C9U5 |
Locus tag | NL732_RS24305 | Protein ID | WP_000813644.1 |
Coordinates | 45516..45734 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS24295 (NL732_24295) | 42177..43046 | - | 870 | Protein_28 | IS5 family transposase | - |
NL732_RS24300 (NL732_24300) | 43626..44830 | + | 1205 | WP_086011258.1 | IS3 family transposase | - |
NL732_RS24305 (NL732_24305) | 45516..45734 | + | 219 | WP_000813644.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NL732_RS24310 (NL732_24310) | 45736..46041 | + | 306 | WP_001159862.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NL732_RS24315 (NL732_24315) | 46099..46312 | + | 214 | Protein_32 | hypothetical protein | - |
NL732_RS24320 (NL732_24320) | 46350..47132 | + | 783 | WP_000083588.1 | site-specific integrase | - |
NL732_RS24325 (NL732_24325) | 47283..48224 | - | 942 | WP_000728920.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NL732_RS24330 (NL732_24330) | 48650..49855 | + | 1206 | WP_000427674.1 | AAA family ATPase | - |
NL732_RS24335 (NL732_24335) | 49855..50829 | + | 975 | WP_000064273.1 | ParB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81966 | 81966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11519.31 Da Isoelectric Point: 5.8326
>T251213 WP_001159862.1 NZ_CP100719:45736-46041 [Salmonella enterica subsp. enterica serovar Weltevreden]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSDKVPRDLYPVMHIGDESYRLLTTDMASVPATVIGEEV
ADLSLQENDIRNAINLMFRGV
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSDKVPRDLYPVMHIGDESYRLLTTDMASVPATVIGEEV
ADLSLQENDIRNAINLMFRGV
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4V6H280 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U8C9U5 |