Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4788973..4789589 Replicon chromosome
Accession NZ_CP100718
Organism Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NL732_RS23185 Protein ID WP_000238494.1
Coordinates 4788973..4789347 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NL732_RS23190 Protein ID WP_001523745.1
Coordinates 4789347..4789589 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL732_RS23170 (4786475) 4786475..4787377 + 903 WP_000331361.1 formate dehydrogenase subunit beta -
NL732_RS23175 (4787374) 4787374..4788009 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NL732_RS23180 (4788006) 4788006..4788935 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NL732_RS23185 (4788973) 4788973..4789347 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NL732_RS23190 (4789347) 4789347..4789589 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NL732_RS23195 (4789794) 4789794..4790723 + 930 WP_001162862.1 alpha/beta hydrolase -
NL732_RS23200 (4790809) 4790809..4791120 + 312 WP_000558163.1 type II toxin-antitoxin system HigB family toxin -
NL732_RS23205 (4791117) 4791117..4791563 + 447 WP_001259011.1 type II toxin-antitoxin system HigA family antitoxin -
NL732_RS23210 (4791578) 4791578..4792519 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NL732_RS23215 (4792564) 4792564..4793001 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NL732_RS23220 (4792998) 4792998..4793870 - 873 WP_000921423.1 virulence factor BrkB family protein -
NL732_RS23225 (4793864) 4793864..4794463 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T251210 WP_000238494.1 NZ_CP100718:c4789347-4788973 [Salmonella enterica subsp. enterica serovar Weltevreden]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT251210 WP_001523745.1 NZ_CP100718:c4789589-4789347 [Salmonella enterica subsp. enterica serovar Weltevreden]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References