Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4788973..4789589 | Replicon | chromosome |
Accession | NZ_CP100718 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q8Z2U3 |
Locus tag | NL732_RS23185 | Protein ID | WP_000238494.1 |
Coordinates | 4788973..4789347 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8E9YHE9 |
Locus tag | NL732_RS23190 | Protein ID | WP_001523745.1 |
Coordinates | 4789347..4789589 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS23170 (4786475) | 4786475..4787377 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
NL732_RS23175 (4787374) | 4787374..4788009 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL732_RS23180 (4788006) | 4788006..4788935 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NL732_RS23185 (4788973) | 4788973..4789347 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NL732_RS23190 (4789347) | 4789347..4789589 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | Antitoxin |
NL732_RS23195 (4789794) | 4789794..4790723 | + | 930 | WP_001162862.1 | alpha/beta hydrolase | - |
NL732_RS23200 (4790809) | 4790809..4791120 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | - |
NL732_RS23205 (4791117) | 4791117..4791563 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NL732_RS23210 (4791578) | 4791578..4792519 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NL732_RS23215 (4792564) | 4792564..4793001 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
NL732_RS23220 (4792998) | 4792998..4793870 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NL732_RS23225 (4793864) | 4793864..4794463 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13908.18 Da Isoelectric Point: 7.3567
>T251210 WP_000238494.1 NZ_CP100718:c4789347-4788973 [Salmonella enterica subsp. enterica serovar Weltevreden]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|