Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4487850..4488631 | Replicon | chromosome |
Accession | NZ_CP100718 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | NL732_RS21905 | Protein ID | WP_000626100.1 |
Coordinates | 4487850..4488341 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NL732_RS21910 | Protein ID | WP_001110452.1 |
Coordinates | 4488338..4488631 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS21875 (4483856) | 4483856..4484941 | - | 1086 | WP_000099893.1 | DNA cytosine methyltransferase | - |
NL732_RS21880 (4485111) | 4485111..4485605 | - | 495 | WP_000622310.1 | GNAT family N-acetyltransferase | - |
NL732_RS21885 (4485602) | 4485602..4485895 | - | 294 | WP_001110462.1 | DUF1778 domain-containing protein | - |
NL732_RS21890 (4486219) | 4486219..4486263 | - | 45 | WP_079827815.1 | hypothetical protein | - |
NL732_RS21895 (4486673) | 4486673..4486750 | + | 78 | Protein_4287 | porin family protein | - |
NL732_RS21900 (4486850) | 4486850..4487602 | + | 753 | WP_000842409.1 | non-specific acid phosphatase | - |
NL732_RS21905 (4487850) | 4487850..4488341 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
NL732_RS21910 (4488338) | 4488338..4488631 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NL732_RS21915 (4488948) | 4488948..4489169 | + | 222 | WP_043991167.1 | hypothetical protein | - |
NL732_RS21920 (4489430) | 4489430..4490305 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
NL732_RS21925 (4490302) | 4490302..4490589 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NL732_RS21930 (4490565) | 4490565..4490765 | - | 201 | WP_001534538.1 | ATP-binding cassette domain-containing protein | - |
NL732_RS21935 (4490785) | 4490785..4490987 | + | 203 | Protein_4295 | hypothetical protein | - |
NL732_RS21940 (4490995) | 4490995..4491262 | + | 268 | Protein_4296 | hypothetical protein | - |
NL732_RS21945 (4491557) | 4491557..4492462 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4463797..4491177 | 27380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T251209 WP_000626100.1 NZ_CP100718:c4488341-4487850 [Salmonella enterica subsp. enterica serovar Weltevreden]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT251209 WP_001110452.1 NZ_CP100718:c4488631-4488338 [Salmonella enterica subsp. enterica serovar Weltevreden]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1DGA4 |