Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4336023..4336539 | Replicon | chromosome |
Accession | NZ_CP100718 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I6CHB9 |
Locus tag | NL732_RS21160 | Protein ID | WP_000220581.1 |
Coordinates | 4336023..4336307 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NL732_RS21165 | Protein ID | WP_000212724.1 |
Coordinates | 4336297..4336539 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS21145 (4331234) | 4331234..4332886 | + | 1653 | WP_000155038.1 | alpha,alpha-phosphotrehalase | - |
NL732_RS21150 (4333295) | 4333295..4335433 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NL732_RS21155 (4335555) | 4335555..4336019 | + | 465 | WP_001268862.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NL732_RS21160 (4336023) | 4336023..4336307 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL732_RS21165 (4336297) | 4336297..4336539 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NL732_RS21170 (4336617) | 4336617..4338530 | - | 1914 | WP_001212140.1 | BglG family transcription antiterminator | - |
NL732_RS21175 (4338547) | 4338547..4339287 | - | 741 | WP_000779255.1 | KDGP aldolase family protein | - |
NL732_RS21180 (4339284) | 4339284..4340402 | - | 1119 | WP_001139192.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NL732_RS21185 (4340386) | 4340386..4341519 | - | 1134 | WP_000459951.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T251207 WP_000220581.1 NZ_CP100718:c4336307-4336023 [Salmonella enterica subsp. enterica serovar Weltevreden]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I6CHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |