Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4282577..4283127 | Replicon | chromosome |
Accession | NZ_CP100718 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NL732_RS20875 | Protein ID | WP_001199743.1 |
Coordinates | 4282577..4282885 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | NL732_RS20880 | Protein ID | WP_000016244.1 |
Coordinates | 4282888..4283127 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS20860 (4280059) | 4280059..4280175 | + | 117 | Protein_4085 | transposase | - |
NL732_RS20865 (4280401) | 4280401..4281420 | - | 1020 | WP_001023050.1 | IS110 family transposase | - |
NL732_RS20870 (4281487) | 4281487..4282453 | + | 967 | Protein_4087 | IS3 family transposase | - |
NL732_RS20875 (4282577) | 4282577..4282885 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NL732_RS20880 (4282888) | 4282888..4283127 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NL732_RS20885 (4283240) | 4283240..4283488 | - | 249 | WP_000254752.1 | ribbon-helix-helix domain-containing protein | - |
NL732_RS20890 (4283565) | 4283565..4283720 | - | 156 | Protein_4091 | DUF4942 domain-containing protein | - |
NL732_RS20895 (4283711) | 4283711..4284572 | - | 862 | Protein_4092 | IS630 family transposase | - |
NL732_RS20900 (4285350) | 4285350..4286375 | + | 1026 | WP_000369883.1 | phage portal protein | - |
NL732_RS20905 (4286403) | 4286403..4288073 | - | 1671 | WP_000368629.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4280401..4296722 | 16321 | |
- | inside | IScluster/Tn | - | - | 4280059..4284527 | 4468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T251206 WP_001199743.1 NZ_CP100718:c4282885-4282577 [Salmonella enterica subsp. enterica serovar Weltevreden]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |