Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4231542..4232118 | Replicon | chromosome |
Accession | NZ_CP100718 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | NL732_RS20670 | Protein ID | WP_001131963.1 |
Coordinates | 4231831..4232118 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
Locus tag | NL732_RS20665 | Protein ID | WP_000063143.1 |
Coordinates | 4231542..4231844 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS20650 (4228053) | 4228053..4230203 | + | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
NL732_RS20655 (4230298) | 4230298..4230501 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
NL732_RS20660 (4230512) | 4230512..4231468 | + | 957 | WP_000187837.1 | GTPase | - |
NL732_RS20665 (4231542) | 4231542..4231844 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
NL732_RS20670 (4231831) | 4231831..4232118 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
NL732_RS20675 (4232387) | 4232387..4233301 | - | 915 | WP_000290515.1 | restriction endonuclease | - |
NL732_RS20680 (4233499) | 4233499..4237008 | + | 3510 | WP_001043490.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T251205 WP_001131963.1 NZ_CP100718:c4232118-4231831 [Salmonella enterica subsp. enterica serovar Weltevreden]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT251205 WP_000063143.1 NZ_CP100718:c4231844-4231542 [Salmonella enterica subsp. enterica serovar Weltevreden]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|