Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2395421..2395943 | Replicon | chromosome |
| Accession | NZ_CP100718 | ||
| Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | NL732_RS11755 | Protein ID | WP_000221343.1 |
| Coordinates | 2395421..2395705 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
| Locus tag | NL732_RS11760 | Protein ID | WP_000885426.1 |
| Coordinates | 2395695..2395943 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL732_RS11730 (2390981) | 2390981..2392222 | - | 1242 | WP_001095731.1 | MFS transporter | - |
| NL732_RS11735 (2392212) | 2392212..2393720 | - | 1509 | WP_000199407.1 | FAD-dependent oxidoreductase | - |
| NL732_RS11740 (2393765) | 2393765..2394253 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NL732_RS11745 (2394446) | 2394446..2395093 | + | 648 | Protein_2299 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NL732_RS11750 (2395089) | 2395089..2395250 | - | 162 | Protein_2300 | RidA family protein | - |
| NL732_RS11755 (2395421) | 2395421..2395705 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL732_RS11760 (2395695) | 2395695..2395943 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL732_RS11765 (2396095) | 2396095..2396214 | + | 120 | Protein_2303 | type II and III secretion system | - |
| NL732_RS11770 (2396300) | 2396300..2396632 | + | 333 | WP_000253078.1 | DUF1493 family protein | - |
| NL732_RS11775 (2396921) | 2396921..2397202 | - | 282 | WP_000742000.1 | hypothetical protein | - |
| NL732_RS11780 (2397504) | 2397504..2398970 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
| NL732_RS11785 (2399228) | 2399228..2400235 | + | 1008 | WP_000201070.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251197 WP_000221343.1 NZ_CP100718:c2395705-2395421 [Salmonella enterica subsp. enterica serovar Weltevreden]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5X3FYG4 |