Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 32214..32736 Replicon plasmid pR17.5474_294k
Accession NZ_CP100716
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag NL730_RS24515 Protein ID WP_000220561.1
Coordinates 32214..32495 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NL730_RS24520 Protein ID WP_000121743.1
Coordinates 32485..32736 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL730_RS24485 (NL730_24485) 27690..27926 - 237 Protein_34 hypothetical protein -
NL730_RS24490 (NL730_24490) 27947..28741 - 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
NL730_RS24495 (NL730_24495) 28770..30200 - 1431 Protein_36 IS4-like element IS50R family transposase -
NL730_RS24500 (NL730_24500) 30320..30508 + 189 WP_000957857.1 hypothetical protein -
NL730_RS24505 (NL730_24505) 30518..31717 + 1200 WP_000948429.1 IS91 family transposase -
NL730_RS24510 (NL730_24510) 31883..31975 + 93 Protein_39 IS6 family transposase -
NL730_RS24515 (NL730_24515) 32214..32495 - 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL730_RS24520 (NL730_24520) 32485..32736 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NL730_RS24525 (NL730_24525) 33775..34472 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
NL730_RS24530 (NL730_24530) 34553..35257 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
NL730_RS24535 (NL730_24535) 35291..35473 - 183 WP_042634467.1 hypothetical protein -
NL730_RS24540 (NL730_24540) 35794..35961 + 168 WP_000803860.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB4 / blaDHA-1 / sul1 / aph(3')-IIa / floR / aph(4)-Ia / aac(3)-IVa / mph(A) / qacE / aadA2 / dfrA12 / tet(A) / cmlA1 / ant(3'')-Ia / sul3 / aph(3'')-Ib / aph(6)-Id - 1..294171 294171
- inside IScluster/Tn qnrB4 / blaDHA-1 / sul1 / aph(3')-IIa - 17392..34472 17080


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T251192 WP_000220561.1 NZ_CP100716:c32495-32214 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT251192 WP_000121743.1 NZ_CP100716:c32736-32485 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References