Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 32214..32736 | Replicon | plasmid pR17.5474_294k |
| Accession | NZ_CP100716 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D0QMR1 |
| Locus tag | NL730_RS24515 | Protein ID | WP_000220561.1 |
| Coordinates | 32214..32495 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | NL730_RS24520 | Protein ID | WP_000121743.1 |
| Coordinates | 32485..32736 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL730_RS24485 (NL730_24485) | 27690..27926 | - | 237 | Protein_34 | hypothetical protein | - |
| NL730_RS24490 (NL730_24490) | 27947..28741 | - | 795 | WP_000572405.1 | aminoglycoside O-phosphotransferase APH(3')-IIa | - |
| NL730_RS24495 (NL730_24495) | 28770..30200 | - | 1431 | Protein_36 | IS4-like element IS50R family transposase | - |
| NL730_RS24500 (NL730_24500) | 30320..30508 | + | 189 | WP_000957857.1 | hypothetical protein | - |
| NL730_RS24505 (NL730_24505) | 30518..31717 | + | 1200 | WP_000948429.1 | IS91 family transposase | - |
| NL730_RS24510 (NL730_24510) | 31883..31975 | + | 93 | Protein_39 | IS6 family transposase | - |
| NL730_RS24515 (NL730_24515) | 32214..32495 | - | 282 | WP_000220561.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL730_RS24520 (NL730_24520) | 32485..32736 | - | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| NL730_RS24525 (NL730_24525) | 33775..34472 | + | 698 | WP_094096600.1 | IS1-like element IS1A family transposase | - |
| NL730_RS24530 (NL730_24530) | 34553..35257 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NL730_RS24535 (NL730_24535) | 35291..35473 | - | 183 | WP_042634467.1 | hypothetical protein | - |
| NL730_RS24540 (NL730_24540) | 35794..35961 | + | 168 | WP_000803860.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB4 / blaDHA-1 / sul1 / aph(3')-IIa / floR / aph(4)-Ia / aac(3)-IVa / mph(A) / qacE / aadA2 / dfrA12 / tet(A) / cmlA1 / ant(3'')-Ia / sul3 / aph(3'')-Ib / aph(6)-Id | - | 1..294171 | 294171 | |
| - | inside | IScluster/Tn | qnrB4 / blaDHA-1 / sul1 / aph(3')-IIa | - | 17392..34472 | 17080 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11023.86 Da Isoelectric Point: 10.5938
>T251192 WP_000220561.1 NZ_CP100716:c32495-32214 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I302 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |