Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4397521..4398302 | Replicon | chromosome |
Accession | NZ_CP100715 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NL730_RS21605 | Protein ID | WP_000626099.1 |
Coordinates | 4397521..4398012 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NL730_RS21610 | Protein ID | WP_001110452.1 |
Coordinates | 4398009..4398302 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL730_RS21565 (4392707) | 4392707..4392949 | - | 243 | WP_197603740.1 | hypothetical protein | - |
NL730_RS21570 (4392946) | 4392946..4393302 | - | 357 | WP_033567083.1 | hypothetical protein | - |
NL730_RS21575 (4393299) | 4393299..4394171 | - | 873 | WP_033567082.1 | ParA family protein | - |
NL730_RS21580 (4394362) | 4394362..4394439 | - | 78 | Protein_4221 | helix-turn-helix domain-containing protein | - |
NL730_RS21585 (4394530) | 4394530..4394862 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NL730_RS21590 (4394934) | 4394934..4395311 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NL730_RS21595 (4396344) | 4396344..4396418 | + | 75 | Protein_4224 | porin family protein | - |
NL730_RS21600 (4396521) | 4396521..4397273 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NL730_RS21605 (4397521) | 4397521..4398012 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NL730_RS21610 (4398009) | 4398009..4398302 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NL730_RS21615 (4398619) | 4398619..4398840 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NL730_RS21620 (4399105) | 4399105..4399980 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NL730_RS21625 (4399977) | 4399977..4400264 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NL730_RS21630 (4400287) | 4400287..4400502 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NL730_RS21635 (4400510) | 4400510..4400779 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NL730_RS21640 (4401073) | 4401073..4401978 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T251189 WP_000626099.1 NZ_CP100715:c4398012-4397521 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT251189 WP_001110452.1 NZ_CP100715:c4398302-4398009 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|