Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3472929..3473549 | Replicon | chromosome |
Accession | NZ_CP100715 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL730_RS17220 | Protein ID | WP_001280991.1 |
Coordinates | 3473331..3473549 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL730_RS17215 | Protein ID | WP_000344807.1 |
Coordinates | 3472929..3473303 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL730_RS17205 (3468068) | 3468068..3469261 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL730_RS17210 (3469284) | 3469284..3472433 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL730_RS17215 (3472929) | 3472929..3473303 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL730_RS17220 (3473331) | 3473331..3473549 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL730_RS17225 (3473728) | 3473728..3474279 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NL730_RS17230 (3474396) | 3474396..3474866 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NL730_RS17235 (3474922) | 3474922..3475062 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL730_RS17240 (3475068) | 3475068..3475328 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL730_RS17245 (3475553) | 3475553..3477103 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL730_RS17255 (3477334) | 3477334..3477723 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL730_RS17260 (3477756) | 3477756..3478325 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251184 WP_001280991.1 NZ_CP100715:3473331-3473549 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251184 WP_000344807.1 NZ_CP100715:3472929-3473303 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|