Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 838330..838990 | Replicon | chromosome |
Accession | NZ_CP100715 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NL730_RS04040 | Protein ID | WP_000244756.1 |
Coordinates | 838577..838990 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NL730_RS04035 | Protein ID | WP_000351186.1 |
Coordinates | 838330..838596 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL730_RS04015 (834258) | 834258..835691 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
NL730_RS04020 (835850) | 835850..836161 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
NL730_RS04025 (836325) | 836325..836984 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
NL730_RS04030 (837100) | 837100..838080 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
NL730_RS04035 (838330) | 838330..838596 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NL730_RS04040 (838577) | 838577..838990 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
NL730_RS04045 (839043) | 839043..839564 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
NL730_RS04050 (839677) | 839677..840573 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NL730_RS04055 (840597) | 840597..841310 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL730_RS04060 (841316) | 841316..843049 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T251176 WP_000244756.1 NZ_CP100715:838577-838990 [Salmonella enterica subsp. enterica serovar Typhimurium]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT251176 WP_000351186.1 NZ_CP100715:838330-838596 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |