Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 2526..3127 Replicon plasmid pR18.0186_78k
Accession NZ_CP100711
Organism Salmonella enterica subsp. enterica serovar Blockley strain R18.0186

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NL733_RS23890 Protein ID WP_247780674.1
Coordinates 2526..2906 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A3P5HIB7
Locus tag NL733_RS23895 Protein ID WP_001190709.1
Coordinates 2906..3127 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL733_RS23870 (NL733_23870) 322..816 + 495 WP_165474253.1 dUTP diphosphatase -
NL733_RS23875 (NL733_23875) 831..1508 + 678 WP_223598024.1 DUF2829 domain-containing protein -
NL733_RS23880 (NL733_23880) 1515..2291 + 777 WP_223598023.1 hypothetical protein -
NL733_RS23885 (NL733_23885) 2324..2521 - 198 WP_223598022.1 PdcA protein -
NL733_RS23890 (NL733_23890) 2526..2906 - 381 WP_247780674.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL733_RS23895 (NL733_23895) 2906..3127 - 222 WP_001190709.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL733_RS23900 (NL733_23900) 3200..3589 - 390 WP_000506727.1 S24 family peptidase -
NL733_RS23905 (NL733_23905) 3633..3932 - 300 WP_223598021.1 antitoxin PHD -
NL733_RS23910 (NL733_23910) 3916..4665 - 750 WP_223598020.1 hypothetical protein -
NL733_RS23915 (NL733_23915) 4662..4871 - 210 WP_000206673.1 hypothetical protein -
NL733_RS23920 (NL733_23920) 4896..5189 - 294 WP_000267996.1 hypothetical protein -
NL733_RS23925 (NL733_23925) 5213..5494 - 282 WP_114447226.1 ASCH domain-containing protein -
NL733_RS23930 (NL733_23930) 5487..6014 - 528 WP_254520892.1 DUF551 domain-containing protein -
NL733_RS23935 (NL733_23935) 6016..6492 - 477 WP_196114205.1 hypothetical protein -
NL733_RS23940 (NL733_23940) 6489..7361 - 873 WP_137441762.1 phosphoadenosine phosphosulfate reductase family protein -
NL733_RS23945 (NL733_23945) 7371..8051 - 681 WP_247779487.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid floR - 1..77896 77896


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13502.20 Da        Isoelectric Point: 5.6343

>T251171 WP_247780674.1 NZ_CP100711:c2906-2526 [Salmonella enterica subsp. enterica serovar Blockley]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEASATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELAGLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8167.12 Da        Isoelectric Point: 4.7708

>AT251171 WP_001190709.1 NZ_CP100711:c3127-2906 [Salmonella enterica subsp. enterica serovar Blockley]
MQSINFRTARGNFSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3P5HIB7

References